Ormone di rilascio della corticotropina

Da Wikipedia, l'enciclopedia libera.
Jump to navigation Jump to search
Ormone di rilascio della corticotropina
PBB Protein CRH image.jpg
Gene
HUGO CRH CRF
Entrez 1392
Locus Chr. 8 q13.1
Proteina
OMIM 122560
UniProt P06850

L'ormone di rilascio della corticotropina, abbreviato in CRH (dall'inglese corticotropin-releasing hormone, e originariamente conosciuto come CRF, ovvero corticotropin-releasing factor), e anche chiamato corticoliberina, è un ormone polipeptidico ipotalamico, nonché un neurotrasmettitore, coinvolto nella risposta agli stress.

Azione ormonale[modifica | modifica wikitesto]

Il CRH è prodotto dalle cellule neuroendocrine del nucleo paraventricolare dell'ipotalamo; è rilasciato dalle terminazioni di tali neuroni nell'eminenza mediana dell'adenoipofisi. Entra nei capillari primari del circolo portale dell'adenoipofisi, i quali lo portano alle cellule corticotrope dell'adenoipofisi. Sotto tale stimolazione dette cellule rilasciano corticotropina (ACTH) e altre sostanze biologiche (per esempio β-endorfina). La corticotropina, che entra nel circolo sistemico, va a stimolare la produzione degli ormoni surrenali, in particolare quella dei glucocorticoidi come il cortisolo.

Azione come neurotrasmettitore[modifica | modifica wikitesto]

I recettori per il CRH sono stati trovati in numerosi siti del cervello, cioè significa che tale peptide, rilasciato dalle terminazioni nervose, ha, nel cervello, funzioni di neurotrasmettitore. Per esempio, i recettori per il CRH sono stati riscontrati nei neuroni del nucleo paraventricolare stesso, nel nucleo centrale dell'amigdala, nella stria terminale e nel locus ceruleus.

Ruolo nella gravidanza[modifica | modifica wikitesto]

Il CRH è sintetizzato anche dalla placenta e sembra determinare il mantenimento della gravidanza.[1].

Struttura[modifica | modifica wikitesto]

La sequenza di 41 amminoacidi del CRH fu scoperta nella pecora dal gruppo di Vale, nel 1981[2] La sequenza completa è:

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

Note[modifica | modifica wikitesto]

  1. ^ Hormones of the Hypothalamus Archiviato il 27 giugno 2012 in Internet Archive.
  2. ^ Vale,W., Spiess,J., Rivier,C. and Rivier,J. Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin Science 213 (4514), 1394-1397 (1981)

Voci correlate[modifica | modifica wikitesto]