Ormone di rilascio della corticotropina

Da Wikipedia, l'enciclopedia libera.

L'ormone di rilascio della corticotropina, abbreviato in CRH (dall’inglese Corticotropin-releasing hormone, e originariamente conosciuto come CRF ovvero corticotropin-releasing factor), ed anche chiamato corticoliberina, è un ormone polipeptidico ipotalamico, nonché un neurotrasmettitore, coinvolto nella risposta agli stress.

Azione ormonale[modifica | modifica wikitesto]

Il CRH è prodotto dalle cellule neuroendocrine del nucleo paraventricolare dell’ipotalamo; è rilasciato dalle terminazioni di tali neuroni nell’eminenza mediana dell’adenoipofisi. Entra nei capillari primari del circolo portale dell'adenoipofisi, i quali lo portano alle cellule corticotrope dell’adenoipofisi. Sotto tale stimolazione dette cellule rilasciano corticotropina (ACTH) e altre sostanze biologiche (per esempio β-endorfina). La corticotropina, che entra nel circolo sistemico, va a stimolare la produzione degli ormoni surrenali, in particolare quella dei glucocorticoidi come il cortisolo.

Azione come neurotrasmettitore[modifica | modifica wikitesto]

I recettori per il CRH sono stati trovati in numerosi siti del cervello, cioè significa che tale peptide, rilasciato dalle terminazioni nervose, ha, nel cervello, funzioni di neurotrasmettitore. Per esempio, i recettori per il CRH sono stati riscontrati nei neuroni del nucleo paraventricolare stesso, nel nucleo centrale dell’amigdala, nella stria terminale e nel locus ceruleus.

Ruolo nella gravidanza[modifica | modifica wikitesto]

Il CRH è sintetizzato anche dalla placenta e sembra determinare il mantenimento della gravidanza.[1].

Struttura[modifica | modifica wikitesto]

La sequenza di 41 amminoacidi del CRH fu scoperta nella pecora dal gruppo di Vale, nel 1981[2] La sequenza completa è:

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

Note[modifica | modifica wikitesto]

  1. ^ Hormones of the Hypothalamus
  2. ^ Vale,W., Spiess,J., Rivier,C. and Rivier,J. Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin Science 213 (4514), 1394-1397 (1981)

Voci correlate[modifica | modifica wikitesto]